BCMA (No Tag)

BCMA is an integral membrane type I protein that is preferentially expressed in mature B lymphocytes, but not in T-cells or monocytes.

Interacting protein(s): BAFF (P7003M), APRIL (P7002F)
Related products: TNF-Receptor Superfamily

Read all details below including Quick Specs.

** Please note: For orders over 1 mg, please inquire here

Quick Specs

Description

BCMA is an integral membrane type I protein that is preferentially expressed in mature B lymphocytes, but not in T-cells or monocytes. BCMA binds to the tumor necrosis factor (ligand) superfamily, BAFF and APRIL and its cytoplasmic tail associates with TNF receptor-associated factor 1 (TRAF1), TRAF2, and TRAF3, TRAF5, TRAF6 and activates NF-κB, elk-1, c-Jun N-terminal kinase, and p38 mitogen-activated protein kinase. It was shown that APRIL stimulates in vitro proliferation of primary B and T cells and increases spleen weight due to accumulation of B cells in vivo. APRIL binds to BCMA and TACI (transmembrane activator and CAML-interactor) and competes with BAFF for receptor binding.

Soluble BCMA and TACI specifically prevent binding of APRIL and block APRIL-stimulated proliferation of primary B cells. BCMA-Fc also inhibits production of antibodies against keyhole limpet hemocyanin and Pneumovax in mice, indicating that APRIL and/or BAFF signaling via BCMA and/or TACI are required for generation of humoral immunity. Thus, APRIL-BAFF and BCMA-TACI form two ligands-two receptors pathway involved in stimulation of B and T cell function.

Amino Acid Sequence.

DVDP AGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKG GPENLYFQ

References

1. Emde-Rajaratnam M, Beck S, Benes V, Salwender H, Bertsch U, Scheid C, et al. RNA-sequencing based first choice of treatment and determination of risk in multiple myeloma. Front Immunol. 2023;14:1286700. Epub 20231115. doi: 10.3389/fimmu.2023.1286700. PubMed PMID: 38035078; PubMed Central PMCID: PMC10684778.

2. A new gene, BCM, on chromosome 16 is fused to the interleukin 2 gene by a t(4;16)(q26;p13) translocation in a malignant T cell lymphoma. Laabi Y., Gras M.P., Carbonnel F., Brouet J.C., Berger R., Larsen C.-J., Tsapis A. EMBO J. 11:3897-3904 (1992)

3. APRIL and TALL-I and receptors BCMA and TACI: system for regulating humoral immunity. Yu G., Boone T., Delaney J., Hawkins N., Kelley M.J., Ramakrishnan M., McCabe S., Qiu W.R., Kornuc M., Xia X.-Z., Guo J., Stolina M., Boyle W.J., Sarosi I., Hsu H., Senaldi G., Theill L.E. Nat. Immunol. 1:252-256 (2000)

4. Comparison of soluble decoy IgG fusion proteins of BAFF-R and BCMA as antagonists for BAFF. Pelletier M, Thompson JS, Qian F, Bixler SA, Gong D, Cachero T, Gilbride K, Day E, Zafari M, Benjamin C, Gorelik L, Whitty A, Kalled SL, Ambrose C, Hsu YM. J Biol Chem.278(35):33127-33 (2003)

5. Ligand-receptor binding revealed by the TNF family member TALL-1. Liu Y., Hong X., Kappler J., Jiang L., Zhang R., Xu L., Pan C.-H., Martin W.E., Murphy R.C., Shu H.-B., Dai S., Zhang G. Nature 423:49-56 (2003)